Anti PLEKHA6 pAb (ATL-HPA054311)

Atlas Antibodies

Catalog No.: ATL-HPA054311-25

Protein Description: pleckstrin homology domain containing, family A member 6
Gene Name: PLEKHA6
Alternative Gene Name: KIAA0969, PEPP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041757: 91%, ENSRNOG00000016877: 29%
Entrez Gene ID: 22874
Uniprot ID: Q9Y2H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDKRHAFRNGGGPAYQLREWKEPASYGRQDATVWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSARF
• Gene Sequence: EDKRHAFRNGGGPAYQLREWKEPASYGRQDATVWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSARF
• Gene ID - Mouse: ENSMUSG00000041757
• Gene ID - Rat: ENSRNOG00000016877
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.