Anti PLCB2 pAb (ATL-HPA069308 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA069308-25

Protein Description: phospholipase C beta 2
Gene Name: PLCB2
Alternative Gene Name: FLJ38135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040061: 77%, ENSRNOG00000058337: 81%
Entrez Gene ID: 5330
Uniprot ID: Q00722
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
• Gene Sequence: PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
• Gene ID - Mouse: ENSMUSG00000040061
• Gene ID - Rat: ENSRNOG00000058337
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.