Anti PLA2G4F pAb (ATL-HPA056752 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056752-25

• 

Protein Description: phospholipase A2, group IVF
Gene Name: PLA2G4F
Alternative Gene Name: PLA2G4F/Z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046971: 77%, ENSRNOG00000037231: 42%
Entrez Gene ID: 255189
Uniprot ID: Q68DD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVNRTFRTHLAPGVERQTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDRHQARERA
• Gene Sequence: LVNRTFRTHLAPGVERQTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDRHQARERA
• Gene ID - Mouse: ENSMUSG00000046971
• Gene ID - Rat: ENSRNOG00000037231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.