Anti PLA2G4E pAb (ATL-HPA041105 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041105-25

Protein Description: phospholipase A2, group IVE
Gene Name: PLA2G4E
Alternative Gene Name: FLJ45651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050211: 79%, ENSRNOG00000024904: 82%
Entrez Gene ID: 123745
Uniprot ID: Q3MJ16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCLLDTAFFVNSSYPPLLRPERKADLIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVTFFPLIN
• Gene Sequence: LCLLDTAFFVNSSYPPLLRPERKADLIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVTFFPLIN
• Gene ID - Mouse: ENSMUSG00000050211
• Gene ID - Rat: ENSRNOG00000024904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.