Anti PLA2G15 pAb (ATL-HPA041702 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041702-25

Protein Description: phospholipase A2, group XV
Gene Name: PLA2G15
Alternative Gene Name: GXVPLA2, LLPL, LYPLA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031903: 91%, ENSRNOG00000019859: 92%
Entrez Gene ID: 23659
Uniprot ID: Q8NCC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED
• Gene Sequence: GVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFED
• Gene ID - Mouse: ENSMUSG00000031903
• Gene ID - Rat: ENSRNOG00000019859
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.