Anti PKIG pAb (ATL-HPA042703)

Atlas Antibodies

Catalog No.: ATL-HPA042703-25

Protein Description: protein kinase (cAMP-dependent, catalytic) inhibitor gamma
Gene Name: PKIG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035268: 87%, ENSRNOG00000010235: 87%
Entrez Gene ID: 11142
Uniprot ID: Q9Y2B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS
• Gene Sequence: DIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS
• Gene ID - Mouse: ENSMUSG00000035268
• Gene ID - Rat: ENSRNOG00000010235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.