Anti PIKFYVE pAb (ATL-HPA042604)

Atlas Antibodies

Catalog No.: ATL-HPA042604-25

Protein Description: phosphoinositide kinase, FYVE finger containing
Gene Name: PIKFYVE
Alternative Gene Name: FAB1, KIAA0981, MGC40423, p235, PIKfyve, PIP5K, PIP5K3, ZFYVE29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025949: 98%, ENSRNOG00000015158: 98%
Entrez Gene ID: 200576
Uniprot ID: Q9Y2I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQA
• Gene Sequence: NVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQA
• Gene ID - Mouse: ENSMUSG00000025949
• Gene ID - Rat: ENSRNOG00000015158
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.