Anti PIGQ pAb (ATL-HPA061414)

Atlas Antibodies

Catalog No.: ATL-HPA061414-25

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class Q
Gene Name: PIGQ
Alternative Gene Name: GPI1, hGPI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025728: 98%, ENSRNOG00000020140: 98%
Entrez Gene ID: 9091
Uniprot ID: Q9BRB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ
• Gene Sequence: YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ
• Gene ID - Mouse: ENSMUSG00000025728
• Gene ID - Rat: ENSRNOG00000020140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.