Anti PIAS3 pAb (ATL-HPA067383)

Atlas Antibodies

Catalog No.: ATL-HPA067383-25

Protein Description: protein inhibitor of activated STAT, 3
Gene Name: PIAS3
Alternative Gene Name: FLJ14651, ZMIZ5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028101: 93%, ENSRNOG00000021218: 90%
Entrez Gene ID: 10401
Uniprot ID: Q9Y6X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD
• Gene Sequence: ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD
• Gene ID - Mouse: ENSMUSG00000028101
• Gene ID - Rat: ENSRNOG00000021218
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.