Anti PHOSPHO2 pAb (ATL-HPA034726)

Atlas Antibodies

Catalog No.: ATL-HPA034726-25

Protein Description: phosphatase, orphan 2
Gene Name: PHOSPHO2
Alternative Gene Name: MGC22679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027088: 83%, ENSRNOG00000007979: 80%
Entrez Gene ID: 493911
Uniprot ID: Q8TCD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQ
• Gene Sequence: QIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQ
• Gene ID - Mouse: ENSMUSG00000027088
• Gene ID - Rat: ENSRNOG00000007979
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.