Anti PHKA1 pAb (ATL-HPA075355 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA075355-25

Protein Description: phosphorylase kinase regulatory subunit alpha 1
Gene Name: PHKA1
Alternative Gene Name: PHKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034055: 86%, ENSRNOG00000003063: 88%
Entrez Gene ID: 5255
Uniprot ID: P46020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWG
• Gene Sequence: VPSVRVEIHLPRDQSGEVDFKALVLQLKETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWG
• Gene ID - Mouse: ENSMUSG00000034055
• Gene ID - Rat: ENSRNOG00000003063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.