Anti PHC3 pAb (ATL-HPA062031)

Atlas Antibodies

SKU: ATL-HPA062031-25

• 

Protein Description: polyhomeotic homolog 3 (Drosophila)
Gene Name: PHC3
Alternative Gene Name: EDR3, FLJ12729, FLJ12967, HPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037652: 96%, ENSRNOG00000009491: 99%
Entrez Gene ID: 80012
Uniprot ID: Q8NDX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMIAEETLEEMDSELLKCEFCGK
• Gene Sequence: RSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMIAEETLEEMDSELLKCEFCGK
• Gene ID - Mouse: ENSMUSG00000037652
• Gene ID - Rat: ENSRNOG00000009491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.