Anti PGM2 pAb (ATL-HPA040676 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040676-25

Protein Description: phosphoglucomutase 2
Gene Name: PGM2
Alternative Gene Name: FLJ10983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029171: 88%, ENSRNOG00000002185: 88%
Entrez Gene ID: 55276
Uniprot ID: Q96G03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVH
• Gene Sequence: PHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVH
• Gene ID - Mouse: ENSMUSG00000029171
• Gene ID - Rat: ENSRNOG00000002185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.