Anti PGD pAb (ATL-HPA031314 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031314-25

Protein Description: phosphogluconate dehydrogenase
Gene Name: PGD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028961: 98%, ENSRNOG00000057626: 94%
Entrez Gene ID: 5226
Uniprot ID: P52209
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGS
• Gene Sequence: FNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGS
• Gene ID - Mouse: ENSMUSG00000028961
• Gene ID - Rat: ENSRNOG00000057626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PGD pAb (ATL-HPA031314 w/enhanced validation) – 4 Found

Gillis, Joanna L; Hinneh, Josephine A; Ryan, Natalie K; Irani, Swati; Moldovan, Max; Quek, Lake-Ee; Shrestha, Raj K; Hanson, Adrienne R; Xie, Jianling; Hoy, Andrew J; Holst, Jeff; Centenera, Margaret M; Mills, Ian G; Lynn, David J; Selth, Luke A; Butler, Lisa M. A feedback loop between the androgen receptor and 6-phosphogluoconate dehydrogenase (6PGD) drives prostate cancer growth. Elife. 2021;10( 34382934) 

Daneshmandi, Saeed; Cassel, Teresa; Higashi, Richard M; Fan, Teresa W-M; Seth, Pankaj. 6-Phosphogluconate dehydrogenase (6PGD), a key checkpoint in reprogramming of regulatory T cells metabolism and function. Elife. 2021;10( 34709178) 

Hambardikar, Vedangi; Guitart-Mampel, Mariona; Scoma, Ernest R; Urquiza, Pedro; Nagana, Gowda G A; Raftery, Daniel; Collins, John A; Solesio, Maria E. Enzymatic Depletion of Mitochondrial Inorganic Polyphosphate (polyP) Increases the Generation of Reactive Oxygen Species (ROS) and the Activity of the Pentose Phosphate Pathway (PPP) in Mammalian Cells. Antioxidants (Basel, Switzerland). 2022;11(4) 

Daneshmandi, Saeed; Cassel, Teresa; Lin, Penghui; Higashi, Richard M; Wulf, Gerburg M; Boussiotis, Vassiliki A; Fan, Teresa W-M; Seth, Pankaj. Blockade of 6-phosphogluconate dehydrogenase generates CD8(+) effector T cells with enhanced anti-tumor function. Cell Reports. 2021;34(10):108831.