Anti PGAM5 pAb (ATL-HPA036978 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036978-25

Protein Description: phosphoglycerate mutase family member 5
Gene Name: PGAM5
Alternative Gene Name: BXLBv68, MGC5352
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029500: 94%, ENSRNOG00000037443: 92%
Entrez Gene ID: 192111
Uniprot ID: Q96HS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
• Gene Sequence: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
• Gene ID - Mouse: ENSMUSG00000029500
• Gene ID - Rat: ENSRNOG00000037443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PGAM5 pAb (ATL-HPA036978 w/enhanced validation) – 4 Found

Holze, Cathleen; Michaudel, Chloé; Mackowiak, Claire; Haas, Darya A; Benda, Christian; Hubel, Philipp; Pennemann, Friederike L; Schnepf, Daniel; Wettmarshausen, Jennifer; Braun, Marianne; Leung, Daisy W; Amarasinghe, Gaya K; Perocchi, Fabiana; Staeheli, Peter; Ryffel, Bernhard; Pichlmair, Andreas. Oxeiptosis, a ROS-induced caspase-independent apoptosis-like cell-death pathway. Nature Immunology. 2018;19(2):130-140. 

Zhao, Tian; Goedhart, Caitlin M; Sam, Pingdewinde N; Sabouny, Rasha; Lingrell, Susanne; Cornish, Adam J; Lamont, Ryan E; Bernier, Francois P; Sinasac, David; Parboosingh, Jillian S; Vance, Jean E; Claypool, Steven M; Innes, A Micheil; Shutt, Timothy E. PISD is a mitochondrial disease gene causing skeletal dysplasia, cataracts, and white matter changes. Life Science Alliance. 2019;2(2) 

Zeb, Akbar; Choubey, Vinay; Gupta, Ruby; Kuum, Malle; Safiulina, Dzhamilja; Vaarmann, Annika; Gogichaishvili, Nana; Liiv, Mailis; Ilves, Ivar; Tämm, Kaido; Veksler, Vladimir; Kaasik, Allen. A novel role of KEAP1/PGAM5 complex: ROS sensor for inducing mitophagy. Redox Biology. 2021;48( 34801863):102186. 

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.