Anti PEX16 pAb (ATL-HPA043286)

Atlas Antibodies

Catalog No.: ATL-HPA043286-100

Protein Description: peroxisomal biogenesis factor 16
Gene Name: PEX16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027222: 83%, ENSRNOG00000006539: 83%
Entrez Gene ID: 9409
Uniprot ID: Q9Y5Y5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAE
• Gene Sequence: AGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAE
• Gene ID - Mouse: ENSMUSG00000027222
• Gene ID - Rat: ENSRNOG00000006539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.