Anti PELI3 pAb (ATL-HPA062281)

Atlas Antibodies

SKU: ATL-HPA062281-25

• 
• 

Protein Description: pellino E3 ubiquitin protein ligase family member 3
Gene Name: PELI3
Alternative Gene Name: MGC35521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024901: 97%, ENSRNOG00000019950: 97%
Entrez Gene ID: 246330
Uniprot ID: Q8N2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
• Gene Sequence: RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ
• Gene ID - Mouse: ENSMUSG00000024901
• Gene ID - Rat: ENSRNOG00000019950
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.