Anti PEF1 pAb (ATL-HPA061608)

Atlas Antibodies

Catalog No.: ATL-HPA061608-100

Protein Description: penta-EF-hand domain containing 1
Gene Name: PEF1
Alternative Gene Name: PEF1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028779: 69%, ENSRNOG00000013972: 68%
Entrez Gene ID: 553115
Uniprot ID: Q9UBV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
• Gene Sequence: PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA
• Gene ID - Mouse: ENSMUSG00000028779
• Gene ID - Rat: ENSRNOG00000013972
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.