Anti PDPK1 pAb (ATL-HPA035199)

Atlas Antibodies

Catalog No.: ATL-HPA035199-25

Protein Description: 3-phosphoinositide dependent protein kinase 1
Gene Name: PDPK1
Alternative Gene Name: PDK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024122: 93%, ENSRNOG00000006136: 95%
Entrez Gene ID: 5170
Uniprot ID: O15530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKG
• Gene Sequence: HSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKG
• Gene ID - Mouse: ENSMUSG00000024122
• Gene ID - Rat: ENSRNOG00000006136
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.