Anti PDK3 pAb (ATL-HPA072492)

Atlas Antibodies

Catalog No.: ATL-HPA072492-25

Protein Description: pyruvate dehydrogenase kinase, isozyme 3
Gene Name: PDK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035232: 98%, ENSRNOG00000012513: 95%
Entrez Gene ID: 5165
Uniprot ID: Q15120
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF
• Gene Sequence: SAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKTNRTF
• Gene ID - Mouse: ENSMUSG00000035232
• Gene ID - Rat: ENSRNOG00000012513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.