Anti PDIA6 pAb (ATL-HPA034652 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034652-25

Protein Description: protein disulfide isomerase family A, member 6
Gene Name: PDIA6
Alternative Gene Name: ERp5, P5, TXNDC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020571: 98%, ENSRNOG00000050197: 97%
Entrez Gene ID: 10130
Uniprot ID: Q15084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA
• Gene Sequence: YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLA
• Gene ID - Mouse: ENSMUSG00000020571
• Gene ID - Rat: ENSRNOG00000050197
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.