Anti PDE4D pAb (ATL-HPA045895)

Atlas Antibodies

Catalog No.: ATL-HPA045895-25

Protein Description: phosphodiesterase 4D, cAMP-specific
Gene Name: PDE4D
Alternative Gene Name: DPDE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021699: 96%, ENSRNOG00000042536: 98%
Entrez Gene ID: 5144
Uniprot ID: Q08499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
• Gene Sequence: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
• Gene ID - Mouse: ENSMUSG00000021699
• Gene ID - Rat: ENSRNOG00000042536
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.