Anti PCYT1A pAb (ATL-HPA035428)

Atlas Antibodies

Catalog No.: ATL-HPA035428-25

Protein Description: phosphate cytidylyltransferase 1, choline, alpha
Gene Name: PCYT1A
Alternative Gene Name: CT, CTPCT, PCYT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005615: 96%, ENSRNOG00000001762: 96%
Entrez Gene ID: 5130
Uniprot ID: P49585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVR
• Gene Sequence: DGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVR
• Gene ID - Mouse: ENSMUSG00000005615
• Gene ID - Rat: ENSRNOG00000001762
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCYT1A pAb (ATL-HPA035428) – 1 Found

Fu, Guotong; Guy, Clifford S; Chapman, Nicole M; Palacios, Gustavo; Wei, Jun; Zhou, Peipei; Long, Lingyun; Wang, Yong-Dong; Qian, Chenxi; Dhungana, Yogesh; Huang, Hongling; Kc, Anil; Shi, Hao; Rankin, Sherri; Brown, Scott A; Johnson, Amanda; Wakefield, Randall; Robinson, Camenzind G; Liu, Xueyan; Sheyn, Anthony; Yu, Jiyang; Jackowski, Suzanne; Chi, Hongbo. Metabolic control of T(FH) cells and humoral immunity by phosphatidylethanolamine. Nature. 2021;595(7869):724-729.