Anti PCED1B pAb (ATL-HPA043901)

Atlas Antibodies

Catalog No.: ATL-HPA043901-25

Protein Description: PC-esterase domain containing 1B
Gene Name: PCED1B
Alternative Gene Name: FAM113B, MGC16044
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037773: 63%, ENSRNOG00000021221: 61%
Entrez Gene ID: 91523
Uniprot ID: Q96HM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD
• Gene Sequence: LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD
• Gene ID - Mouse: ENSMUSG00000037773
• Gene ID - Rat: ENSRNOG00000021221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.