Anti PCDHGB3 pAb (ATL-HPA035823)

Atlas Antibodies

Catalog No.: ATL-HPA035823-25

Protein Description: protocadherin gamma subfamily B, 3
Gene Name: PCDHGB3
Alternative Gene Name: PCDH-GAMMA-B3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102748: 54%, ENSRNOG00000027296: 51%
Entrez Gene ID: 56102
Uniprot ID: Q9Y5G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEA
• Gene Sequence: FTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEA
• Gene ID - Mouse: ENSMUSG00000102748
• Gene ID - Rat: ENSRNOG00000027296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.