Anti PCDH11X pAb (ATL-HPA077495)

Atlas Antibodies

Catalog No.: ATL-HPA077495-25

Protein Description: protocadherin 11 X-linked
Gene Name: PCDH11X
Alternative Gene Name: PCDH-X, PCDH11, PCDHX, PPP1R119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034755: 81%, ENSRNOG00000004118: 37%
Entrez Gene ID: 27328
Uniprot ID: Q9BZA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQRRVTF
• Gene Sequence: PVSVHTRPPMKEVVRSCTPMKESTTMEIWIHPQPQRKSEGKVAGKSQRRVTF
• Gene ID - Mouse: ENSMUSG00000034755
• Gene ID - Rat: ENSRNOG00000004118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.