Anti PCBP2 pAb (ATL-HPA038356)

Atlas Antibodies

Catalog No.: ATL-HPA038356-25

Protein Description: poly(rC) binding protein 2
Gene Name: PCBP2
Alternative Gene Name: hnRNP-E2, HNRNPE2, HNRPE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056851: 100%, ENSRNOG00000036852: 100%
Entrez Gene ID: 5094
Uniprot ID: Q15366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
• Gene Sequence: IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
• Gene ID - Mouse: ENSMUSG00000056851
• Gene ID - Rat: ENSRNOG00000036852
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCBP2 pAb (ATL-HPA038356) – 1 Found

Flynn, Ryan A; Martin, Lance; Spitale, Robert C; Do, Brian T; Sagan, Selena M; Zarnegar, Brian; Qu, Kun; Khavari, Paul A; Quake, Stephen R; Sarnow, Peter; Chang, Howard Y. Dissecting noncoding and pathogen RNA-protein interactomes. Rna (New York, N.y.). 2015;21(1):135-43.