Anti PATJ pAb (ATL-HPA069079)

Atlas Antibodies

SKU: ATL-HPA069079-25

• 

Protein Description: PATJ, crumbs cell polarity complex component
Gene Name: PATJ
Alternative Gene Name: Cipp, INADL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061859: 89%, ENSRNOG00000007551: 83%
Entrez Gene ID: 10207
Uniprot ID: Q8NI35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
• Gene Sequence: NDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSI
• Gene ID - Mouse: ENSMUSG00000061859
• Gene ID - Rat: ENSRNOG00000007551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.