Anti PATE1 pAb (ATL-HPA076587)

Atlas Antibodies

Catalog No.: ATL-HPA076587-25

Protein Description: prostate and testis expressed 1
Gene Name: PATE1
Alternative Gene Name: PATE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091215: 58%, ENSRNOG00000049600: 56%
Entrez Gene ID: 160065
Uniprot ID: Q8WXA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE
• Gene Sequence: LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE
• Gene ID - Mouse: ENSMUSG00000091215
• Gene ID - Rat: ENSRNOG00000049600
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.