Anti PARD6A pAb (ATL-HPA041551)

Atlas Antibodies

Catalog No.: ATL-HPA041551-25

Protein Description: par-6 family cell polarity regulator alpha
Gene Name: PARD6A
Alternative Gene Name: PAR-6, PAR-6A, PAR6alpha, TAX40, TIP-40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005699: 76%, ENSRNOG00000017746: 73%
Entrez Gene ID: 50855
Uniprot ID: Q9NPB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS
• Gene Sequence: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS
• Gene ID - Mouse: ENSMUSG00000005699
• Gene ID - Rat: ENSRNOG00000017746
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.