Anti PAF1 pAb (ATL-HPA041875)

Atlas Antibodies

Catalog No.: ATL-HPA041875-25

Protein Description: Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)
Gene Name: PAF1
Alternative Gene Name: F23149_1, FLJ11123, PD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003437: 100%, ENSRNOG00000019746: 100%
Entrez Gene ID: 54623
Uniprot ID: Q8N7H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY
• Gene Sequence: EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY
• Gene ID - Mouse: ENSMUSG00000003437
• Gene ID - Rat: ENSRNOG00000019746
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.