Anti PACRG pAb (ATL-HPA066293 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA066293-25

Protein Description: PARK2 co-regulated
Gene Name: PACRG
Alternative Gene Name: FLJ32724, Glup, HAK005771, PARK2CRG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037196: 94%, ENSRNOG00000008299: 29%
Entrez Gene ID: 135138
Uniprot ID: Q96M98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF
• Gene Sequence: AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF
• Gene ID - Mouse: ENSMUSG00000037196
• Gene ID - Rat: ENSRNOG00000008299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.