Anti PABPC4 pAb (ATL-HPA056496 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA056496-100

Protein Description: poly(A) binding protein, cytoplasmic 4 (inducible form)
Gene Name: PABPC4
Alternative Gene Name: APP-1, iPABP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011257: 98%, ENSRNOG00000015642: 100%
Entrez Gene ID: 8761
Uniprot ID: Q13310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP
• Gene Sequence: QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP
• Gene ID - Mouse: ENSMUSG00000011257
• Gene ID - Rat: ENSRNOG00000015642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.