Anti OMG pAb (ATL-HPA012693 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012693-100
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA012693 antibody. Corresponding OMG RNA-seq data are presented for the same tissues.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: oligodendrocyte myelin glycoprotein
Gene Name: OMG
Alternative Gene Name: OMGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049612: 97%, ENSRNOG00000014107: 97%
Entrez Gene ID: 4974
Uniprot ID: P23515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNK
Gene Sequence LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNK
Gene ID - Mouse ENSMUSG00000049612
Gene ID - Rat ENSRNOG00000014107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OMG pAb (ATL-HPA012693 w/enhanced validation)
Datasheet Anti OMG pAb (ATL-HPA012693 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OMG pAb (ATL-HPA012693 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti OMG pAb (ATL-HPA012693 w/enhanced validation)
Datasheet Anti OMG pAb (ATL-HPA012693 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OMG pAb (ATL-HPA012693 w/enhanced validation)
Citations for Anti OMG pAb (ATL-HPA012693 w/enhanced validation) – 1 Found
Chang, Kae-Jiun; Susuki, Keiichiro; Dours-Zimmermann, Maria T; Zimmermann, Dieter R; Rasband, Matthew N. Oligodendrocyte myelin glycoprotein does not influence node of ranvier structure or assembly. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2010;30(43):14476-81.  PubMed
!