Anti OFD1 pAb (ATL-HPA031104)

Atlas Antibodies

Catalog No.: ATL-HPA031104-25

Protein Description: oral-facial-digital syndrome 1
Gene Name: OFD1
Alternative Gene Name: 71-7A, CXorf5, JBTS10, RP23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040586: 76%, ENSRNOG00000004574: 74%
Entrez Gene ID: 8481
Uniprot ID: O75665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
An alternative product for ATL-HPA041223.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNH
• Gene Sequence: SFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNH
• Gene ID - Mouse: ENSMUSG00000040586
• Gene ID - Rat: ENSRNOG00000004574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OFD1 pAb (ATL-HPA031104) – 1 Found

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535)