Anti NUP210 pAb (ATL-HPA066888)

Atlas Antibodies

Catalog No.: ATL-HPA066888-25

Protein Description: nucleoporin 210kDa
Gene Name: NUP210
Alternative Gene Name: FLJ22389, GP210, KIAA0906, POM210
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030091: 81%, ENSRNOG00000005390: 81%
Entrez Gene ID: 23225
Uniprot ID: Q8TEM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTSLEGLSGTWSSSANSILHIDPKTGVAV
• Gene Sequence: TFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPTNNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTSLEGLSGTWSSSANSILHIDPKTGVAV
• Gene ID - Mouse: ENSMUSG00000030091
• Gene ID - Rat: ENSRNOG00000005390
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NUP210 pAb (ATL-HPA066888) – 1 Found

Wurlitzer, Marcus; Möckelmann, Nikolaus; Kriegs, Malte; Vens, Maren; Omidi, Maryam; Hoffer, Konstantin; Bargen, Clara von; Möller-Koop, Christina; Witt, Melanie; Droste, Conrad; Oetting, Agnes; Petersen, Hannes; Busch, Chia-Jung; Münscher, Adrian; Schlüter, Hartmut; Clauditz, Till Sebastian; Rieckmann, Thorsten. Mass Spectrometric Comparison of HPV-Positive and HPV-Negative Oropharyngeal Cancer. Cancers. 2020;12(6)