Anti NUMBL pAb (ATL-HPA058251)

Atlas Antibodies

Catalog No.: ATL-HPA058251-25

Protein Description: numb homolog (Drosophila)-like
Gene Name: NUMBL
Alternative Gene Name: CAG3A, CTG3a, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063160: 88%, ENSRNOG00000020867: 86%
Entrez Gene ID: 9253
Uniprot ID: Q9Y6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPFVPAYPGLGYPPMP
• Gene Sequence: PTMPPALQPFPAPVGPFDAAPAQVAVFLPPPHMQPPFVPAYPGLGYPPMP
• Gene ID - Mouse: ENSMUSG00000063160
• Gene ID - Rat: ENSRNOG00000020867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.