Anti NUF2 pAb (ATL-HPA059692)

Atlas Antibodies

Catalog No.: ATL-HPA059692-25

Protein Description: NUF2, NDC80 kinetochore complex component
Gene Name: NUF2
Alternative Gene Name: CDCA1, CT106, NUF2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026683: 72%, ENSRNOG00000002711: 82%
Entrez Gene ID: 83540
Uniprot ID: Q9BZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
• Gene Sequence: ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
• Gene ID - Mouse: ENSMUSG00000026683
• Gene ID - Rat: ENSRNOG00000002711
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.