Anti NUDT8 pAb (ATL-HPA041466 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041466-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 8
Gene Name: NUDT8
Alternative Gene Name: FLJ41567
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110949: 81%, ENSRNOG00000017955: 79%
Entrez Gene ID: 254552
Uniprot ID: Q8WV74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVD
• Gene Sequence: KCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVD
• Gene ID - Mouse: ENSMUSG00000110949
• Gene ID - Rat: ENSRNOG00000017955
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.