Anti NUDT15 pAb (ATL-HPA038969)

Atlas Antibodies

Catalog No.: ATL-HPA038969-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 15
Gene Name: NUDT15
Alternative Gene Name: FLJ10956, MTH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033405: 90%, ENSRNOG00000025239: 90%
Entrez Gene ID: 55270
Uniprot ID: Q9NV35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL
• Gene Sequence: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL
• Gene ID - Mouse: ENSMUSG00000033405
• Gene ID - Rat: ENSRNOG00000025239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NUDT15 pAb (ATL-HPA038969) – 1 Found

Hughes, Daniel Llwyd; Willenbrock, Frances; Soonawalla, Zahir; Mukherjee, Somnath; O'Neill, Eric. Predicting Early Disease Recurrence of Pancreatic Cancer following Surgery: Determining the Role of NUDT15 as a Prognostic Biomarker. Current Oncology (Toronto, Ont.). 2022;29(4):2516-2529.