Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA074873-25

• 

Protein Description: neurotrophic receptor tyrosine kinase 2
Gene Name: NTRK2
Alternative Gene Name: TRKB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055254: 92%, ENSRNOG00000018839: 92%
Entrez Gene ID: 4915
Uniprot ID: Q16620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS
• Gene Sequence: INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS
• Gene ID - Mouse: ENSMUSG00000055254
• Gene ID - Rat: ENSRNOG00000018839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.