Anti NTPCR pAb (ATL-HPA054304)

Atlas Antibodies

Catalog No.: ATL-HPA054304-25

Protein Description: nucleoside-triphosphatase, cancer-related
Gene Name: NTPCR
Alternative Gene Name: C1orf57, HCR-NTPase, MGC13186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031851: 83%, ENSRNOG00000019922: 81%
Entrez Gene ID: 84284
Uniprot ID: Q9BSD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
• Gene Sequence: PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
• Gene ID - Mouse: ENSMUSG00000031851
• Gene ID - Rat: ENSRNOG00000019922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.