Anti NSD1 pAb (ATL-HPA070333)

Atlas Antibodies

Catalog No.: ATL-HPA070333-25

Protein Description: nuclear receptor binding SET domain protein 1
Gene Name: NSD1
Alternative Gene Name: ARA267, FLJ22263, KMT3B, STO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021488: 80%, ENSRNOG00000016680: 72%
Entrez Gene ID: 64324
Uniprot ID: Q96L73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSEC
• Gene Sequence: FSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSVMNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSEC
• Gene ID - Mouse: ENSMUSG00000021488
• Gene ID - Rat: ENSRNOG00000016680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.