Anti NRIP2 pAb (ATL-HPA039197 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039197-25

Protein Description: nuclear receptor interacting protein 2
Gene Name: NRIP2
Alternative Gene Name: DKFZP761G1913
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000108011: 76%, ENSRNOG00000042939: 75%
Entrez Gene ID: 83714
Uniprot ID: Q9BQI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV
• Gene Sequence: LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV
• Gene ID - Mouse: ENSMUSG00000108011
• Gene ID - Rat: ENSRNOG00000042939
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.