Anti NR5A1 pAb (ATL-HPA079181)

Atlas Antibodies

SKU: ATL-HPA079181-25

• 

Protein Description: nuclear receptor subfamily 5 group A member 1
Gene Name: NR5A1
Alternative Gene Name: AD4BP, ELP, FTZ1, FTZF1, hSF-1, SF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026751: 88%, ENSRNOG00000012682: 90%
Entrez Gene ID: 2516
Uniprot ID: Q13285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
• Gene Sequence: VPELILQLLQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQT
• Gene ID - Mouse: ENSMUSG00000026751
• Gene ID - Rat: ENSRNOG00000012682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.