Anti NR2E1 pAb (ATL-HPA055642 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055642-25

• 

Protein Description: nuclear receptor subfamily 2, group E, member 1
Gene Name: NR2E1
Alternative Gene Name: TLL, TLX, XTLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019803: 99%, ENSRNOG00000050550: 99%
Entrez Gene ID: 7101
Uniprot ID: Q9Y466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSY
• Gene Sequence: IPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSY
• Gene ID - Mouse: ENSMUSG00000019803
• Gene ID - Rat: ENSRNOG00000050550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.