Anti NPPC pAb (ATL-HPA035362)

Atlas Antibodies

Catalog No.: ATL-HPA035362-25

Protein Description: natriuretic peptide C
Gene Name: NPPC
Alternative Gene Name: CNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026241: 92%, ENSRNOG00000018854: 95%
Entrez Gene ID: 4880
Uniprot ID: P23582
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
• Gene Sequence: PKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
• Gene ID - Mouse: ENSMUSG00000026241
• Gene ID - Rat: ENSRNOG00000018854
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPPC pAb (ATL-HPA035362) – 1 Found

Michel, Konstanze; Herwig, Melissa; Werner, Franziska; Špiranec Spes, Katarina; Abeßer, Marco; Schuh, Kai; Dabral, Swati; Mügge, Andreas; Baba, Hideo A; Skryabin, Boris V; Hamdani, Nazha; Kuhn, Michaela. C-type natriuretic peptide moderates titin-based cardiomyocyte stiffness. Jci Insight. 2020;5(22)