Anti NOSIP pAb (ATL-HPA043464 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043464-25

Protein Description: nitric oxide synthase interacting protein
Gene Name: NOSIP
Alternative Gene Name: CGI-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003421: 97%, ENSRNOG00000020543: 98%
Entrez Gene ID: 51070
Uniprot ID: Q9Y314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGT
• Gene Sequence: RHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGT
• Gene ID - Mouse: ENSMUSG00000003421
• Gene ID - Rat: ENSRNOG00000020543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.