Anti NOS1 pAb (ATL-HPA058312)

Atlas Antibodies

Catalog No.: ATL-HPA058312-25

Protein Description: nitric oxide synthase 1 (neuronal)
Gene Name: NOS1
Alternative Gene Name: nNOS, NOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029361: 94%, ENSRNOG00000001130: 95%
Entrez Gene ID: 4842
Uniprot ID: P29475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
• Gene Sequence: LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
• Gene ID - Mouse: ENSMUSG00000029361
• Gene ID - Rat: ENSRNOG00000001130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.