Anti NOP2 pAb (ATL-HPA040119)

Atlas Antibodies

Catalog No.: ATL-HPA040119-25

Protein Description: NOP2 nucleolar protein
Gene Name: NOP2
Alternative Gene Name: NOL1, NOP120, NSUN1, p120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038279: 95%, ENSRNOG00000018453: 95%
Entrez Gene ID: 4839
Uniprot ID: P46087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH
• Gene Sequence: KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH
• Gene ID - Mouse: ENSMUSG00000038279
• Gene ID - Rat: ENSRNOG00000018453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.