Anti NOP2 pAb (ATL-HPA040119)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040119-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NOP2
Alternative Gene Name: NOL1, NOP120, NSUN1, p120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038279: 95%, ENSRNOG00000018453: 95%
Entrez Gene ID: 4839
Uniprot ID: P46087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH |
| Gene Sequence | KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH |
| Gene ID - Mouse | ENSMUSG00000038279 |
| Gene ID - Rat | ENSRNOG00000018453 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NOP2 pAb (ATL-HPA040119) | |
| Datasheet | Anti NOP2 pAb (ATL-HPA040119) Datasheet (External Link) |
| Vendor Page | Anti NOP2 pAb (ATL-HPA040119) at Atlas Antibodies |
| Documents & Links for Anti NOP2 pAb (ATL-HPA040119) | |
| Datasheet | Anti NOP2 pAb (ATL-HPA040119) Datasheet (External Link) |
| Vendor Page | Anti NOP2 pAb (ATL-HPA040119) |